PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00022.1.g04290.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 275aa    MW: 30355.6 Da    PI: 9.2445
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00022.1.g04290.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.19.3e-342680155
                         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                    kprlrWtp+LHerFveav++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Zjn_sc00022.1.g04290.1.sm.mkhc 26 KPRLRWTPDLHERFVEAVTKLGGPDKATPKSVLRLMGMKGLTLYHLKSHLQKYRL 80
                                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.0322383IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.0E-332381IPR009057Homeodomain-like
SuperFamilySSF466899.32E-172683IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-252681IPR006447Myb domain, plants
PfamPF002498.4E-102879IPR001005SANT/Myb domain
PfamPF143793.7E-24125169IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MFEGMERAGY GAAAAMGGVV LSRDPKPRLR WTPDLHERFV EAVTKLGGPD KATPKSVLRL  60
MGMKGLTLYH LKSHLQKYRL GKQNKKDTGL EARRGAFAAQ GINFSAPAPP TIASAASNST  120
GETPLADALK YQIEVQRKLH EQLEVQKKLQ MRIEAQGKYL QTILEKAQSN LSYDASGAEN  180
LEATRSQLTD FNLALSGFMD NVTQVCEQNS GELTKAMSQD NLRTSNIGFQ LYHGVQDVED  240
VKCTPDDGLL LLDLNIRGGY GHRPLSDLKI NQHMR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953575.11e-177PREDICTED: myb family transcription factor APL-like
SwissprotQ9SAK54e-52APL_ARATH; Myb family transcription factor APL
TrEMBLK3YUV31e-177K3YUV3_SETIT; Uncharacterized protein
STRINGSi018049m1e-177(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39403470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.11e-65G2-like family protein